PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10024314
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 445aa    MW: 48896.8 Da    PI: 7.4094
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10024314genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.21.4e-11310369564
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 
                  kr +r   NR++A rs +RK  +i eLe+kv++L+ae ++L  ++  l+  +++l+s+++
  Lus10024314 310 KRVKRILANRLSAARSKERKMRYISELEQKVQTLQAEATTLSAQVTVLQRDSSNLTSQNH 369
                  899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.5E-19306370IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.162308371IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.0E-11310367No hitNo description
SuperFamilySSF579592.46E-11310366No hitNo description
PfamPF001702.4E-10310369IPR004827Basic-leucine zipper domain
CDDcd147036.59E-22311360No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MCDSMRQSSP SDSLEEASIN KRIGLPPSHP NNHHILSSGL VSDQQQMGLN RGRPSHSRSL  60
SQSSMFSLDC LPPLSPLQHL SMVGDVSMEE KAGASRGLLV PGSRVNEGLP PRRGHRRSMS  120
DNVPLGFGAM IQSSPQLIPI GGQGGFDRFK LVKQEVEGMG DRRSMVEVGD DMLNAYMDNI  180
DPLNSSGTED KDWDSRVSGT KTNGTENSDN EAESHIKGLK RNADGDIGPA GRHYRTVPMD  240
SFMGSLRLDD ESMKIPPAGN RIGQLSSSSS MQGSLTKFNL EFGNGEFTEA ELKKIMSNDK  300
LTELAMADPK RVKRILANRL SAARSKERKM RYISELEQKV QTLQAEATTL SAQVTVLQRD  360
SSNLTSQNHE LKFRLQAMEQ QAQLKDALNE ALVGEVQRLR LAATDVGADT SHQQQLLSNI  420
MQDQNAYQHQ RQRSTQLNQA QSSK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073848.11e-164PREDICTED: transcription factor VIP1-like
TrEMBLA0A067KLE41e-164A0A067KLE4_JATCU; Uncharacterized protein
STRINGPGSC0003DMT4000041781e-147(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22723484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.31e-101bZIP family protein